PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009758435.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family Dof
Protein Properties Length: 273aa    MW: 30765.2 Da    PI: 8.3701
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009758435.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof126.96.1e-402685362
          zf-Dof  3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62
                    e+a+kcprCdstntkfCyynnysl+qPryfCk+CrryWtkGG+lrnvPvGgg+rknk+ s
  XP_009758435.1 26 EQAQKCPRCDSTNTKFCYYNNYSLTQPRYFCKSCRRYWTKGGTLRNVPVGGGCRKNKRIS 85
                    7899*****************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074782.0E-282383IPR003851Zinc finger, Dof-type
PfamPF027011.2E-332783IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.2832983IPR003851Zinc finger, Dof-type
PROSITE patternPS0136103167IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 273 aa     Download sequence    Send to blast
MSSQTLESML VCTKQDQEKK PRPGAEQAQK CPRCDSTNTK FCYYNNYSLT QPRYFCKSCR  60
RYWTKGGTLR NVPVGGGCRK NKRISSKRSQ DQSLTNSPNN PISSITPTSY DSSSDLSLAF  120
ARLQKQANGN LGIEENDNMS MMYNNHGNNI ASTSFLDTLR GGFLETPNGF QYQNLYYENN  180
MGQVQNGGMG MNNANEEMRM NYDQEMSGGK IVKQEMCNIA REGENNRILW GFPWQINGEV  240
NNMADFEASN RGQNWNTGFG GSSWHGLLNS PLM
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009758434.10.0PREDICTED: dof zinc finger protein DOF2.1-like isoform X1
RefseqXP_016468849.10.0PREDICTED: dof zinc finger protein DOF2.1-like
TrEMBLM1CDP11e-110M1CDP1_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000652711e-110(Solanum tuberosum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60200.14e-40TARGET OF MONOPTEROS 6